MeSH Browser

MeSH Supplementary: lixisenatide
Unique ID: C479460
RDF Unique Identifier: http://id.nlm.nih.gov/mesh/C479460
Entry Term(s): AQVE-10010; AVE 0010; AVE 010; AVE-0010; AVE-010; AVE0010; Adlyxin; DES-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-l-lysyl-l-lysinamide; Lyxumia; ZP 10; ZP-10; ZP10A peptide
Pharm Action: Hypoglycemic Agents
Registry Number: 74O62BB01U
Previous Indexing: *CARRIER PROTEINS (2003-2010)
Heading Mapped to: *Peptides
Frequency: 255
Note: A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).
Source: J Pharmacol Exp Ther 2003 Nov;307(2);490-6
Indexing Information: Glucagon-Like Peptide-1 Receptor
Date of Entry: 2003/12/08
Revision Date: 2016/10/05

lixisenatide MeSH Supplementary Concept Data 2023