NLM Logo

lixisenatide MeSH Supplementary Concept Data 2021


MeSH Supplementary
lixisenatide
Unique ID
C479460
RDF Unique Identifier
http://id.nlm.nih.gov/mesh/C479460
Entry Term(s)
AQVE-10010
AVE 0010
AVE 010
AVE-0010
AVE-010
AVE0010
Adlyxin
DES-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-l-lysyl-l-lysinamide
Lyxumia
ZP 10
ZP-10
ZP10A peptide
Pharm Action
Hypoglycemic Agents
Registry Number
74O62BB01U
Previous Indexing
*CARRIER PROTEINS (2003-2010)
Heading Mapped to
*Peptides
Frequency
242
Note
A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).
Source
J Pharmacol Exp Ther 2003 Nov;307(2);490-6
Indexing Information
Glucagon-Like Peptide-1 Receptor
Date of Entry
2003/12/08
Revision Date
2016/10/05
lixisenatide Preferred
Adlyxin Narrower
AQVE-10010 Narrower
ZP10A peptide Narrower
ZP 10 Narrower
Lyxumia Narrower
AVE 010 Narrower
AVE 0010 Narrower
page delivered in 0.005s